PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G113600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 500aa    MW: 54992.6 Da    PI: 7.2636
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G113600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.87.6e-083123491954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+++e+  LA++ +Lt  qV++WF N R +
  Brast03G113600.2.p 312 FEHflHPYPKENEKLMLARQARLTRGQVSNWFINARVR 349
                         554458******************************88 PP

2BELL79.45e-26181251171
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                         erq l++k   L  ll +V++rY+ y +++++++ss +a+ag g+a+pYt++Al++iSrhFr+L+daia q
  Brast03G113600.2.p 181 ERQGLEIKVRALQGLLGQVEQRYRGYEHEMRALASSLDAAAGRGAARPYTAVALRTISRHFRSLRDAIAAQ 251
                         6889999*************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.2E-31117250IPR006563POX domain
PfamPF075266.1E-34126249IPR006563POX domain
PROSITE profilePS5007111.321290353IPR001356Homeobox domain
SMARTSM003891.3E-6293357IPR001356Homeobox domain
CDDcd000863.92E-9293354No hitNo description
SuperFamilySSF466891.5E-15295360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-26296359IPR009057Homeodomain-like
PfamPF059206.2E-16310349IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MATFFSAPGK HKDIAGGSGD MPFQPYPGSS TAGLAPLPAA AAQGDAQNEL AFMFAAEQSQ  60
IETQQQQMMM MMMMMQSSQA MQQRHGLLSL SLATQVPASL YHHHHYSPAC ADDASLLGAH  120
VAARTSSRYL RAARELLDEL VNVQDAGATT RKPDKNRSHS SGVDGNEDSS PAEEPSPSPS  180
ERQGLEIKVR ALQGLLGQVE QRYRGYEHEM RALASSLDAA AGRGAARPYT AVALRTISRH  240
FRSLRDAIAA QARSARRSLG EPPGVHRLRY VDQRMRRQQL GGGFGEQQKH AAWRPQRGLP  300
EPAVSVLRAW LFEHFLHPYP KENEKLMLAR QARLTRGQVS NWFINARVRL WKPMIEEMYR  360
EEFGEEIMEA ANSSSDKGKD EPEPELARSL QSPLQGVNPF KSTGLEDNAA VYSSIQGLRL  420
HDQRQRQHAY DDTLLHEHDG AGDRFLDLGG SGFTLGLHGR HDGVTLVGLG SAEQPGMDAG  480
AFDRQRFGSS SQLLHDFVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-15299356158Homeobox protein Meis1
4xrs_A1e-15299356158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571779.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLI1I3Z20.0I1I3Z2_BRADI; Uncharacterized protein
STRINGBRADI3G26690.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.14e-75BEL1-like homeodomain 7